PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A10G0190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 195aa    MW: 22330.3 Da    PI: 8.3048
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A10G0190genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.82.5e-081243132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g+W++eEd++l+ ++k++G  +W+  a+  g
      Gh_A10G0190 12 KGAWSPEEDKKLIAYIKRYGIWNWAEMAKPAG 43
                     79******************99****999777 PP

2Myb_DNA-binding59.66.9e-1991134247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g++T+eE+e ++d++++lG++ W+ Ia++++ gRt++++k++w+ +
      Gh_A10G0190  91 GNFTKEEEETIIDLHEKLGNR-WSVIASKLP-GRTDNEIKNHWHAH 134
                      89*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500909.918784IPR017877Myb-like domain
SuperFamilySSF466898.73E-2710131IPR009057Homeodomain-like
SMARTSM007178.6E-71186IPR001005SANT/Myb domain
PfamPF002492.7E-61245IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-221391IPR009057Homeodomain-like
CDDcd001676.38E-71484No hitNo description
PROSITE profilePS5129426.70685139IPR017930Myb domain
SMARTSM007173.5E-1789137IPR001005SANT/Myb domain
PfamPF002491.0E-1691134IPR001005SANT/Myb domain
CDDcd001674.93E-1392135No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2692140IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MAKSVENRAL KKGAWSPEED KKLIAYIKRY GIWNWAEMAK PAGKKNPEID CLYYDFCWVF  60
YGFCLFVGLQ RSGKSCRLRW VNYLRPGIKH GNFTKEEEET IIDLHEKLGN RWSVIASKLP  120
GRTDNEIKNH WHAHLSKRLK YDLNSLPDMS DAEIDQYSSF ETDPPPTNVP NALISESSAA  180
TFTDSLPSSS SNPKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-24313918128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591831e-65AJ459183.1 Gossypium hirsutum partial myb153 gene, clone pGhMYB153.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454562.11e-106PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH43e-46MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A0B0P5101e-117A0A0B0P510_G
STRINGPOPTR_0013s14560.16e-51(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-47myb domain protein 14